PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A05G2508
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 281aa    MW: 31294.8 Da    PI: 4.7414
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A05G2508genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.32.2e-10118164450
                  XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                  +k++rr  +NR AA rsR++Kk++++ Le k+  Le+e ++L   l+
  Gh_A05G2508 118 IKKQRRQLRNRDAAVRSREKKKMYVKDLEMKSRYLEGECRRLSRVLQ 164
                  79************************************999987665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1705.1E-12113177No hitNo description
SMARTSM003381.5E-6115179IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.5E-11118177No hitNo description
PfamPF001702.3E-10118174IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.76119174IPR004827Basic-leucine zipper domain
CDDcd147042.73E-17120171No hitNo description
PROSITE patternPS000360122137IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MEEINWDTLL LEVDLPDFGN ILDNEPVTEP PPQPCSTQNP DEEPAVSSWI GAIEKVLMED  60
DNFDPRVETQ PVSDDDFLAD LLVDSPPSSG GDVAGVDGAD LHKQSQTHTD VDKDDPIIKK  120
QRRQLRNRDA AVRSREKKKM YVKDLEMKSR YLEGECRRLS RVLQCFIAEN QALRLTLHKG  180
CAFDASSAKQ ESAVLLLESL LLGSLLWFLG IMCLFTLPIL PKSVLEAVPM ANEETQGPER  240
VAPRGAGSNR VGPSFVKSRR CKASRGKMKE ISCFMGILIP F
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.21570.0boll| ovule| root| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012447655.11e-176PREDICTED: bZIP transcription factor 60-like
TrEMBLA0A0D2SBE61e-176A0A0D2SBE6_G
STRINGPOPTR_0005s27930.11e-67(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46342848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.13e-28basic region/leucine zipper motif 60